Brand visibility profile
Thesys in AI search
Review AI visibility, citations, and competitors for this brand across ChatGPT, Claude, Perplexity, and Google AI Overview.

Estimated Traffic
0
Based on monthly volumes set per question
Coverage by AI engine
Coverage
Sign in to view the full coverage heatmap and explore every prompt where this brand appears.
Do you want to track your Brand?
7 days Free trial, you can cancel anytime.
AI Citations
Perplexity
2
OpenAI
0
Claude
1
AI Overview
0
Unlock full AI analytics for this brand, including query volumes, mentions and competitor counts.
Sentiment by Source
Mentions
Design patterns for Generative UI in domain tools
claude
I'll search for information about design patterns for Generative UI in domain-specific tools.Let me search for more specific information about design patterns for generative UI in domain-specific appl...
chatgpt
Here’s a compact set of **Generative-UI design patterns** that work well in domain/enterprise tools, with solid references for each:
* **Ask → Edit → Agent (mode switching)**: start with Q\&A, escala...
perplexity
...dards.[2][3]
## Best Practices
- Build with a **dedicated design system** for Generative UI (like Thesys "Crayon"), emphasizing accessibility, interactivity, and responsive layouts.[2]
- Use **itera...
google ai overview
Define Generative UI vs chatbots; enterprise examples
claude
...chatbots conduct multi-turn dialogue to gather scheduling preferences.[2]
- **Internal Tools (e.g., Thesys C1):** Enterprises are moving from chatbots toward platforms where AI generates micro-apps or...
chatgpt
Here’s a clear distinction, plus concrete **enterprise examples** and a **whitepaper reference**.
---
## Generative UI vs. Chatbots
**Chatbots**
* **Interface**: primarily conversational, linear, ...
perplexity
...chatbots conduct multi-turn dialogue to gather scheduling preferences.[2]
- **Internal Tools (e.g., Thesys C1):** Enterprises are moving from chatbots toward platforms where AI generates micro-apps or...
google ai overview
Missing out
Prompts where at least 2 other brands have answers.
Sign in to uncover prompts this brand is missing where competitors already appear.
AI Citations (Brand)
Thesys pages found in AI answers, estimated global monthly visits: 35
Unlock the exact URLs from this brand that AI assistants cite most frequently.
AI Social Citation
Social network links that appear in AI answers across this brand's analyzed queries.
Sign in to see which social profiles AI answers link to for this brand.
AI Citations from Articles and News (Top 20)
Filtered to blogs, newsrooms, resources, insights, and reports.
Log in to explore the news and blog articles most cited by AI answers.
AI Citations (Top 20)
All other external websites cited by AI answers.
Competitors
Explore similar brands
k2viewtowardsdatasciencesciencedirectmergetelerikdevpulsegetaprototypecoveomartinfowlerCloudgithubmockplusshapeofPairdesigningforanalyticsElsewhencsgiworkativwebionimbleappgeniequokkalabsnngrouprubyroidlabshtcincuiverseunosquareDonwenresearchgatemdpidesignsystemscollectiveideatheoremrogerwongdialzararamotionJakobnielsenphda16z